PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_08389A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 485aa    MW: 51192.1 Da    PI: 8.8911
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_08389AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.72.3e-17119165148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                +g+WTteEde+l+  v ++G + W+ +a++++ gR +kqc++rw ++l
  Oropetium_20150105_08389A 119 KGPWTTEEDEILKIKVMEHGERKWAVVAKYLP-GRIGKQCRERWTNHL 165
                                79******************************.************996 PP

2Myb_DNA-binding52.51.1e-16171213145
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                +g WT+ +d++l+ ++k++G++ W+ Ia++++ gR+++ +k++w+
  Oropetium_20150105_08389A 171 KGMWTKKDDDILIAGHKLHGNR-WSQIAKHLP-GRSENAVKNHWN 213
                                688*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.223117165IPR017930Myb domain
SuperFamilySSF466891.91E-29118212IPR009057Homeodomain-like
SMARTSM007176.9E-16118167IPR001005SANT/Myb domain
PfamPF002495.7E-16119165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-24120172IPR009057Homeodomain-like
CDDcd001674.02E-14121165No hitNo description
PROSITE profilePS5129425.765166220IPR017930Myb domain
SMARTSM007172.6E-15170218IPR001005SANT/Myb domain
PfamPF002496.0E-15171213IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.9E-22173215IPR009057Homeodomain-like
CDDcd001672.43E-13174213No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 485 aa     Download sequence    Send to blast
MEAESSVRFA AQDVSAAGQM MQSGGGGVAH GISTAACMFH PPSSIGAFLA RLGMAPGGMF  60
LPAGSYPAAS YAAVDGTGAN DNAPRNVWNG VVMGGGAGQH PAAPGSGNGE TLAPALLHKG  120
PWTTEEDEIL KIKVMEHGER KWAVVAKYLP GRIGKQCRER WTNHLRPDIK KGMWTKKDDD  180
ILIAGHKLHG NRWSQIAKHL PGRSENAVKN HWNATRRSLK AKRRLKKKRS AQEQGAAAAH  240
PAAGGHLSDL EQYIRSVYPD DVAAAPPAPG AAPPVSPPSS SYNNLGFGEV VSPPRFDPAA  300
AGMGMMMYLN SSGGGSSSSS VSPLSSNVMV SNVNGVLRSS MLLDLNAYYR ETMPPLHHVN  360
ATVGAAAAAD VKPPQQVTMM LGRHDEQQQQ GSASYTDLIM AGYPSSSSFV DSFMWQQQPS  420
AVGGHVAGAG NAANNNSAGH HHAAAEYYXX XXXXXXXXDV VQMASMEFQT PSPEELTLNL  480
ARLM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-4011021750156MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-4011021750156MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-401162171102C-Myb DNA-Binding Domain
1msf_C3e-401162171102C-Myb DNA-Binding Domain
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222229RRLKKKRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188233101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18770.12e-38myb domain protein 98